PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G216900.1.p
Common NameSb09g027200, SORBIDRAFT_09g027200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 323aa    MW: 34663.3 Da    PI: 4.8741
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G216900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.5e-161764148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
  Sobic.009G216900.1.p 17 KGLWSPEEDEKLYNHIIRHGVGCWSSVPKLAGLQRCGKSCRLRWINYL 64
                          678*******************************************97 PP

2Myb_DNA-binding51.91.7e-1670113146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg+++++E++l++ +++ lG++ W+ Ia++++ gRt++++k++w++
  Sobic.009G216900.1.p  70 RGSFSQQEEDLIIALHEILGNR-WSQIASHLP-GRTDNEIKNFWNS 113
                           899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.6221264IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-231267IPR009057Homeodomain-like
SuperFamilySSF466894.87E-2914111IPR009057Homeodomain-like
SMARTSM007172.3E-121666IPR001005SANT/Myb domain
PfamPF002491.0E-141764IPR001005SANT/Myb domain
CDDcd001671.80E-112064No hitNo description
PROSITE profilePS5129426.20265119IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2668119IPR009057Homeodomain-like
SMARTSM007171.5E-1669117IPR001005SANT/Myb domain
PfamPF002495.2E-1570114IPR001005SANT/Myb domain
CDDcd001678.33E-1272112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGRLSCGGGG VQPKLRKGLW SPEEDEKLYN HIIRHGVGCW SSVPKLAGLQ RCGKSCRLRW  60
INYLRPDLKR GSFSQQEEDL IIALHEILGN RWSQIASHLP GRTDNEIKNF WNSCLKKKLR  120
QRGIDPATHK PIAAGAAAEA GTALPDGRDH DRKPGGAADG DGDADGLAQS KQLQPAAAVF  180
DPFPVTDFGF DLGVAALYCG PYDDGKASPD AGFVADYSSV LDVSENLGYG ESSSNSSNWN  240
CGAEMSNAVL DSEVLHWASG AAAAKPEPYT ELEQQQQHSG GYSGGGGQAV DDDDDALEHK  300
FLLPCGGQEQ SLAHFDFNLE YF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28131193108B-MYB
1h8a_C2e-281111921128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114120LKKKLRQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.80241e-137embryo| root| shoot
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0635970.0BT063597.1 Zea mays full-length cDNA clone ZM_BFc0084D02 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440172.10.0hypothetical protein SORBIDRAFT_09g027200
SwissprotP200271e-115MYB3_HORVU; Myb-related protein Hv33
TrEMBLC5YUX10.0C5YUX1_SORBI; Putative uncharacterized protein Sb09g027200
STRINGSb09g027200.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.17e-75myb domain protein 86